<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR249 US2006CR249 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, K20I, P39T, L63P, A71AITV, V77I, I93IL  
>US2006CR249| codons 1-99
PQITLWQRPLVTIKVGGQLIEALLDTGADDTVLEEMNLTGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, G190GA P225PH V35VI, K43KQ, E53D, K101KQ, K102KR, D123E, K126KQ, I135IV, S162SA, D177DE, I178M, I244IV, A272P, V276T, K277R, K281KR, L283I, E297EA G262GE
>US2006CR249| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEQEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQRNKSVTVLDVGDAYFSVPL
DKEFRQYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEMVI
YQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPVVLPEKDSWTVNDIQKLVEKLNWASQIYPGIKTRQLCRLIRGTKALTEVIPLTAEAE
LELAE

References
Author Title Citation
Smith, DM A public health model for the molecular surveillance of HIV transmission in San Diego, California. AIDS, 2009