<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR242 US2006CR242 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K102R, T139K, D177E, I178M, V179I, R211K, F214FL, V245E, T286A, A288AV, E291ED, E297K, A304E H235HR, I293IM
>US2006CR242| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELRPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKVLTDVMPLTKEAE
LELEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, N37NS, I62V, L63P, H69Q, K70E, A71T, I72V, V77I, Q92R  
>US2006CR242| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGQETVGTVLIGPTPVNIIGRNLLTRIGCTLNF

References
Author Title Citation
Smith, DM A public health model for the molecular surveillance of HIV transmission in San Diego, California. AIDS, 2009