<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6800 CA14925 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 170
2 AZT+DDI 56
3 3TC+AZT 22
4 3TC+AZT+SQV 4
5 3TC+AZT+RTV 65
6 D4T+DDI+NVP 39
7 DDC+RTV+SQV 39
8 3TC+ABC+EFV+RTV+SQV 17
9 APV+D4T+DDI 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L33LF K20R, E35D, M36IL, N37T, F53I, R57K, I62V, L63P, V77I, I85V  
>CA14925| codons 12-99
TIKIGGQLREALLDTGADDTVFEDITLPGRWKPKMIGGIGGIIKVKQYDQVPIEICGHKA
IGTVLIGPTPVNVVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, Q151M, T215F A62V, V75T, K219Q K103N, Y188L   K20R, I31R, T39A, A98S, V118I, K122KE, R172K, V179I, I202V, F214L, L228H, T286A, V292I  
>CA14775| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKRKALVEICAELEKEGKISKIGPENPYNTPV
FVIKKKNSDKWRKLTDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIII
YQYMDDLLVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIIPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005