<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR178 US2006CR178 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   E28K, D123E, I135T, S162C, D177E, T200A, I202V, V245E, I293V, P294Q Y232H
>US2006CR178| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGHELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVQLTEEAE
LELAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   K14R, G16GE, G17D, N37T, Q61H, L63R, I64V, T74S, V77I K70V
>US2006CR178| codons 1-99
PQITLWQRPLVTIRIEDQLKEALLDTGADNTVLEEMTLPGRWKPKMIGGIGGFIKVRQYD
HIRVEICGHVAIGSVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Smith, DM A public health model for the molecular surveillance of HIV transmission in San Diego, California. AIDS, 2009