<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6007 CA14915 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 3TC+AZT 26
3 3TC+AZT+NFV 48
4 D4T+DDI+IDV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M N88D L10I, I13V, Q18QH, N37D, K55KR, L63P, I66F, A71V, V77I  
>CA14915| codons 1-99
PQITLWQRPIVTVKIGGHLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFIRVRQYD
QIPIEFCGHKVIGTVLIGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R       K64R, K122E, I135T, I178M, A272T, A288S, I293V, E297A  
>CA14788| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGTKSLTEVVPLTAEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001