<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3977 CA14912 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+ 3TC 39
3 AZT+ 3TC+ IDV 22
4 D4T+ 3TC+ SQV 23
5 DDI+ 3TC+ RTV 25
6 None 20
7 D4T+ NVP+ NFV 32
8 DDI+ 3TC+ ABC+ RTV+ SQV 2
9 None 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, N37S, R41K, L63T, I72V, V77I R8RG
>CA14912| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L     A98AG K20R, V35I, E44ED, V60VI, R83RK, K103KR, D123E, T165TI, H208HY, L210LV, R211K, T215X, A272P, K277R, I293V, E297K  
>CA14765| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKRKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLVKWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005