<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5982 CA14904 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 82
2 3TC+DDI+NFV 13
3 3TC+NFV+NVP 84

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   K20I, M36I, I62V, L63P, I64IV, I72V, T74S  
>CA14904| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKAVGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   K122E, T139R, S162C, S163SG, I178L, R211AT, A272P, K277R, T286TA, E297K, I329L, M357T, R358RK, A376S, V381I, T386I, A400I, V435VI, D460N, L491S, E529D, Q547K, A554ST  
>CA14754| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQCGMTKILEPFRKQNPDLVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKISTESIIIWGKIPKFKLPIQKETWEIWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKDKVYLAWVPAHK
GIGGNEKVDKLVSTGIRKVL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005