Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA5976 | CA14892 | U.S. | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | Unknown | 61 |
| 2 | 3TC+AZT+RTV+SQV | 57 |
| 3 | 3TC+AZT+NFV | 113 |
| 4 | ABC+APV+D4T | 31 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82VA, I84V, L90M | L10I, K20R, E35D, M36I, R41K, I62X, L63P, I64V, A71T, I93L |
| >CA14892| codons 1-99 PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYD QXPVEICGHKTIGTVLVGPTPANVIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |