Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA5966 | CA14879 | U.S. | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC | 52 |
| 2 | AZT+3TC | 65 |
| 3 | D4T+DDI+NVP | 47 |
| 4 | 3TC+AZT+NFV+NVP | 78 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N | I13V, I15V, E35D, M36I, N37T, I64V, I72IV |
| >CA14879| codons 1-99 PQITLWQRPLVTVKVGGQLKEALLDTGADNTVLEDITLPGRWKPKMIGGIGGFIKVRQYD QILVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |