<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5964 CA14877 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 21
2 D4T 47
3 3TC 8
4 3TC+SQV 8
5 3TC+RTV+SQV 4
6 3TC+IDV 43
7 3TC+DDI 8
8 3TC+DDC+DDI+NFV 4
9 3TC+DDI+NFV+NVP 26
10 D4T+ 3TC+NFV+NVP 61
11 ABC+ APV+ EFV 39
12 ABC+ APV+ D4T+ EFV 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M K43T, G73A L10I, Q18QH, K20I, L63P, A71T  
>CA14877| codons 1-99
PQITLWQRPIVTIKIGGHLIEALLDTGADDTVLEEMNLPGRWTPKIIGGIGGFIKVRQYD
QIPIEICGHKTIATVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, Q151M V75T Y181C, G190A V108I, F227L K20R, S68G, V111I, I135L, S162SN, I178L, F214L, H221Y, V245E, A272P, K277R, E297A  
>CA14729| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDIGDAFFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPMGWKGSPAIFQNSMTKILEPFRKQNPDLVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGLTTPDKKYQKEPPLLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTAEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005