<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3932 CA14828 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 60
2 3TC+ D4T+ RTV 30
3 3TC+ DDI+ RTV+ SQV 17
4 3TC+ AZT+ NVP 43
5 DDI+ D4T+ DLV+ NFV 50
6 NFV+ ABC+ ADV+ EFV 45
7 APV+ ABC+ EFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50IV, I54V, V82T, L90M F53FL L10I, I15V, K20R, E35D, M36I, N37E, L63P, A71AV  
>CA14828| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIELPGRWKPKIIGGVGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   K101E, Y181YC, G190A A98G, V108VI, V179VF V35I, E44ED, R83K, V106I, V118I, D123E, I135T, E138A, V189VI, Q197QH, T200A, E203K, Q207E, H208Y, R211K, K223E, T286A, A288S, E297K P1S
>CA14759| codons 1-300
SISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLEKKKSITILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIFI
CQYMDDLYIASDLEIGHHRAKIKELREYLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVIPLTKEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005