<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1855 CA14824 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 D4T 13
3 D4T+DDI+EFV+NFV+Unknown 28
4 ABC+APV+RTV+SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90LM G73S L10I, I62V, L63P, A71V, V77I, I93L  
>CA14824| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVISTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MV, L210W, T215Y   K103KN   T39A, E44D, V118I, K122KE, D123DG, I142IV, K173KE, G196GE, Q207E, H208HY, R211K, K223Q, E224ED E203EDKN
>CA14677| codons 1-229
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIEQHRTKINELREYLWKWGFYTPDKKHQQDPPFLW

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005