<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6031 CA14818 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 3TC+AZT 65
3 DDI+NFV+NVP 87
4 DDI+RTV+SQV 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35I, T39A, K43E, A98S, K122E, I135T, I142V, R211K  
>CA14818| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M L10F, N88D I15V, L63P, V77I, I93L  
>CA14966| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009