<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
68 68PROT Venezuela 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33LI T12A, I13V, K14R, K20M, E35D, M36I, R41RK, R57RK, L63LP, H69HKNQ, L89M  
>68PROT| codons 1-99
PQITLWQRPLVAVRIGGQLMEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E   K20R, K32Q, V35I, T39K, K43E, D86E, I135K, E169D, N175H, G196E, Q197E, V245E P217R
>68RT| codons 1-255
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIQALIEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQEFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQHPDIVI
YQYMDDLYVGSDLEIEEHRTKIEELRQHLLRWGFTTRDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVN

References
Author Title Citation
Castillo, J Surveillance of HIV type 1 drug resistance among naive patients from Venezuela. ARHR, 2009