<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
25 25RT Venezuela 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, T69S, A98S, V118I, I135T, T200A, F214L  
>25RT| codons 3-244
SPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFA
IKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPLDK
DFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQ
PI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, K20KR, N37S, L63A, K70R, A71T, I72E, V77I  
>25PROT| codons 1-99
PQITLWQRPLVPIRIGGQLREALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHRTEGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Castillo, J Surveillance of HIV type 1 drug resistance among naive patients from Venezuela. ARHR, 2009