<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3-00-0122 3-00-0122 Canada 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, M36L, R41K, D60E, H69R, L89M, I93L  
>3-00-0122| codons 1-99
PQITLWQRPLVSIKVGGQVKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYE
QILIEICGRKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, E40D, V118I, K122E, D123S, E138A, I142V, K173T, Q174K, T200A, Q207E, F214L, V245Q, E248EKQ W252W*
>3-00-0122| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPQKDS*

References
Author Title Citation
Jayaraman, GC A population-based approach to determine the prevalence of transmitted drug-resistant HIV among recent versus established HIV infections: results from the Canadian HIV strain and drug resistance surveillance program. JAIDS, 2006