<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5990 CA14766 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT+SQV 126
3 3TC+D4T+NFV 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E     K20R, V35K, T39A, T69TN, W88C, A98AS, K122E, D123E, K154KE, S163SR, G196E, T200A, E203K, F214L N136NS, R211*K
>CA14766| codons 1-219
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFCEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSISNETPGIRYQYNVLPQGWEGSPAIFQSRMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELRQHLWKWGLYTPDE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20V, E35D, M36I, I62V, L63P, I64V, T74S  
>CA14913| codons 1-99
PQITLWQRPLVTIKIGGQLVEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009