<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5981 CA14753 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 3TC+AZT 109
3 3TC+AZT+RTV 74
4 DDI+DLV+NFV 17
5 D4T+DLV+RTV+SQV 65
6 ABC+APV+DDI 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K103N, Y181C, G190A   K20R, T39A, K43E, E44EA, K122P, Q174R, E203D, Q207E, H208Y, R211K, A288S, I293V, P294PA, E297K, A304G  
>CA14753| codons 1-304
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
CQYMDDLYVASDLEIGQHRTKIDELREYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVALTKEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, I84V, L90M   L10I, K20R, E35D, M36I, N37S, R41K, I62V, L63P, A71V, P79S  
>CA14903| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDISLPGKWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGSTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012