<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5979 CA14751 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 3TC+AZT+D4T+DDC+DDI+NVP+NFV+RTV NA
3 NFV+RTV 39
4 DDI+NFV+RTV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184MV, L210W, T215F K219Q K103N, Y181C K238T P9T, K20R, V35VI, K43Q, A98S, V118I, K122E, I135V, S162Y, H208Y, R211K, D218E, L228H  
>CA14751| codons 1-258
PISPIETVTVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFFTPEQKHQKEPPFHWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84IV, L90M F53FL, G73C L10I, K20R, E35D, M36I, N37D, I62V, L63A, I64V, T74S, V77VI  
>CA14901| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGLIKVRQYD
QVAVEICGHKAICSVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005