<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2-00-0622 2-00-0622 Canada 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G17E, E35N, M36I, N37D, R41K, R57K, H69K, L89M  
>2-00-0622| codons 1-99
PQITLWQRPLVTVKIGEQLKEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35T, E40D, V60I, D121H, K122E, D123S, S162C, K166R, K173A, D177E, T200A, R211K, V245Q  
>2-00-0622| codons 1-252
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSW

References
Author Title Citation
Jayaraman, GC A population-based approach to determine the prevalence of transmitted drug-resistant HIV among recent versus established HIV infections: results from the Canadian HIV strain and drug resistance surveillance program. JAIDS, 2006