<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4014 CA14735 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 3TC+AZT 19
3 3TC+DDI 4
4 None 4
5 3TC+D4T 21
6 3TC+D4T+IDV 34
7 None 20
8 EFV+ADV 10
9 ABC+EFV+ADV 12
10 ADV+DDI+EFV 7
11 DDI+EFV 21
12 3TC+AZT+NFV 3
13 3TC+AZT+NFV 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       E44D, E53D, A98S, K122A, E169D, D177E, G196E, T200A, Q207E  
>CA14735| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPDNPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DADFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   R41RS, I64V  
>CA14869| codons 11-99
VTIKIGGQLKEALLDTGADDTVLEEMNLPGSWKPKIIGGIGGFVKVRQYDQILVEICGHK
AIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005