<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1-00-0098 1-00-0098 Canada 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15L, L19Q, K20I, M36I, R41K, H69K, V82I, L89M E21T
>1-00-0098| codons 1-99
PQITLWQRPLVTVKLGGQQITALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V8I, K11T, K20R, V35T, T39K, K43E, S68G, K122E, D123N, I135T, T165I, K173I, Q174K, D177E, I178M, T200A, Q207A, R211S, V245E  
>1-00-0098| codons 1-248
PISPIDTIPVTLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPE

References
Author Title Citation
Jayaraman, GC A population-based approach to determine the prevalence of transmitted drug-resistant HIV among recent versus established HIV infections: results from the Canadian HIV strain and drug resistance surveillance program. JAIDS, 2006