<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5949 CA14712 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 52
2 3TC+AZT+RTV+SQV 26
3 3TC+APV+AZT+RTV 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V     V108I V35I, D121C, K122E, K166R, D177E, G196E, Q207E, R211K, L228N, V245M, A272P, K277R, I293V N265NT
>CA14712| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFNWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLTWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, I62V, L63A, A71V, I72V, T74A, V77I, I93L  
>CA14859| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVAIEICGHKVVGAVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001