<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12729 12729 Spain 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, N37D, R41K, H69K, T74S, L89M  
>12729| codons 4-99
TLWQRPLVTVKIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60L, K104KR, D123E, I135V, S162A, K173T, Q174K, T200A, Q207E, R211K, P243T, V245Q  
>12729| codons 38-247
CTEMEKEGKISKIGPENPYNTPLFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKRSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQTIQLP

References
Author Title Citation
Palacios, R Prevalence of primary resistance mutations in patients with newly diagnosed HIV infection in the province of Malaga (Spain). Enferm Infecc Microbiol Clin, 2008