<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1433 CA14668 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 AZT+ DDC 11
3 AZT 42
4 None 2
5 IDV 5
6 D4T+IDV 37
7 None 11
8 DDI+RTV+SQV 19
9 RTV+SQV 8
10 None 4
11 3TC+ADV+DDI+EFV+NFV+SQV 30
12 ADV+EFV+NFV+SQV 3
13 ADV+D4T+EFV+NFV+SQV 14
14 ADV+D4T+EFV 2
15 3TC+ABC+ADV+D4T+EFV 9
16 3TC+ABC+EFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10V, E35D, M36I, R57K, L63P, A71V, I93L  
>CA14668| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N, M230L V108I A98S, V118VI, D121HY, K122E, Q207E, R211K, K277KR, I293V  
>CA14562| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005