<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1417 CA14658 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+ 3TC 26
3 NFV+ NVP+ DDC 78
4 SQV+ RTV 9
5 SQV+ RTV 18
6 None 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V L10F, L33F, N88D L63P, A71T, I72V  
>CA14658| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVFEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTVGTVLVGPTPVNVIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E K101DE, Y181C, G190A V108I K11R, E53D, K122E, H221Y, V245E, A272P, K277R, V292I  
>CA14524| codons 1-296
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLDKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFITPDEKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIIPLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005