<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
06 HIV_06 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, V118I, D123E, K173I, Q174K, Q207E, R211K, F214L  
>HIV_06| codons 1-219
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61N, K70R, L89M  
>HIV_06| codons 13-99
IKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNILIEICGHRAI
GTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Gonsalez, CR Drug resistance among chronic HIV-1-infected patients naive for use of anti-retroviral therapy in Sao Paulo city. Virus Res, 2007