<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 100
2 LPV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V   I13V, N37D, Q61QR, Q92EK  
>M4| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
RILIEICGHKAIGTVVVGPTPVNIIGRNLLTEIGCTLNF

References
Author Title Citation
Nijhuis, M Failure of treatment with first-line lopinavir boosted with ritonavir can be explained by novel resistance pathways with protease mutation 76V. J Infect Dis, 2009