<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
626 BR06PR626 Brazil 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I15V, G16E, E35D, N37K, R41H, L63H, I64V, H69K, V82I, I93L  
>BR06PR626| codons 1-99
PQITLWQRPLVPIKVEGQLKEALLDTGADDTVLEDMKLPGHWKPKMIGGIGGFIKVRQYD
QIHVEICGKKAIGTVLVGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, I135T, K173A, D177E, T200A, Q207N, R211K, T240S V241R
>BR06PR626| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWS
RQ

References
Author Title Citation
Ferreira, JL Molecular characterisation of newly identified HIV-1 infections in Curitiba, Brazil: Preponderance of clade C among males with recent infections. Mem Ins Oswaldo Cruz, 2008