<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
46 BR06PR46 Brazil 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, S48T, A98S, D123E, I135T, S162C, T200A, Q207N, L210F, R211K, L228H  
>BR06PR46| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLFKWGFTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, K43R, R57K, L63P, K70R, A71T, V77I  
>BR06PR46| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWRPKMIGGIGGFIKVKQYD
QIPIEICGHRTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Ferreira, JL Molecular characterisation of newly identified HIV-1 infections in Curitiba, Brazil: Preponderance of clade C among males with recent infections. Mem Ins Oswaldo Cruz, 2008