<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
41 BR06PR41 Brazil 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V60I, T69S, D86E, W88C, A98S, I135T, E138A, K173E, I202V, R211A, F214L, V245E  
>BR06PR41| codons 1-247
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQEFCEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLAWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, D60E, I62V, L63S, I72M, V77I, I93L  
>BR06PR41| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QVSIEICGHKAMGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Ferreira, JL Molecular characterisation of newly identified HIV-1 infections in Curitiba, Brazil: Preponderance of clade C among males with recent infections. Mem Ins Oswaldo Cruz, 2008