<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1484 CA14619 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 152
2 AZT+DDC 82
3 AZT+D4T 26
4 3TC+AZT+D4T 8
5 3TC+D4T+IDV 108
6 D4T+DDI+NFV+SQV 89

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M F53L, G73GS L10V, N37D, L63P, A71V, I93L  
>CA14619| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, L210W, T215Y K219R     V21I, E28K, K32E, V60I, R83K, K122E, S162Y, E169D, D177E, I178L, R211K, A272P Q258Q*HY, K259K*
>CA14514| codons 1-287
PISPIETVPVKLKPGMDGPKIKQWPLTKEKIEALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIY*LVGKLNWASQIYPGIKVKQLCKLLRGTK

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009