<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1154 CA14618 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ AZT+ SQV 114
3 3TC+ D4T+ SQV 105

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, L90M   L10I, I13IV, K20M, M36X, I62IV, L63P, I64V, A71V, I93L  
>CA14618| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEXNLPGRWKPKMIVGIGGFVKVRQYD
QVPVEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F K219Q     E28EA, K43N, K122E, D177E, G196E, Q197K, D218E, L228LH, A272P Q258QH, K259K*LM
>CA14513| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEKHRTKIEELRQHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIHMLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005