<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
540967 540967 Spain 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LM, I13V, K14KR, K20I, E35Q, M36I, R41K, R57K, C67E, H69K, V82I, L89M  
>540967| codons 1-99
PQITLWQRPMVTVRIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, A98S, K102Q, D123DE, I135V, K173T, Q174K, D177E, T200AE, Q207A, V245Q, E248D, D250E, S251SN, E291D, V292IT, I293V, P294PT, E297K, K311R, I329V T286TAIV
>540967| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHREKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKENWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGVKALTDTVTLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEVQKQG

References
Author Title Citation
Sanchez Onoro, M Primary antiretroviral drug resistance among patients diagnosed with HIV infection in Gran Canaria (Spain) between 2002 and 2005. Enferm Infecc Microbiol Clin, 2007