<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG101 RG101 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L10I, I13V, G16E, E35D, M36L, N37S, K45Q, I62V, L63H, I64V, A71T, I72V, I93L  
>RG101| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADNTVLEDLSLPGRWKPQMIGGIGGFIKVRQYD
QVHVEICGHKTVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009