<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
tvSP21 tvSP21 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI 20
3 3TC+D4T+NFV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, Q61N  
>tvSP21| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, K49R, K122E, D123E, I135L, S162C, K173T, Q174K, D177N, V245L, A272P, K281R, I293V, E297R  
>tvSP21| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPNIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Dumans, AT Distinct resistance mutation and polymorphism acquisition in HIV-1 protease of subtypes B and F1 from children and adult patients under virological failure. Infect Genet Evol, 2009