<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CS172pro CS172pro Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 9
2 Unknown 4
3 AZT+DDI+NFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L N83D G16E, M36L, N37K, R41K, R57K, Q61D, I72R, L89I  
>CS172pro| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEELKLPGKWKPKLIGGIGGFIKVKQYD
DILIEICGHKARGTVLVGPTPVDIIGRNILTQIGCTLNF

References
Author Title Citation
Machado, ES Alternative, age- and viral load-related routes of nelfinavir resistance in human immunodeficiency virus type 1-infected children receiving highly active antiretroviral therapy. Pediatr Infect Dis J, 2004