<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PA365 PA365 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 35
2 AZT+DDI+SQV 65
3 3TC+D4T+IDV 244

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19V, R57K, I62V, A71T, V77I, I93L  
>PA365| codons 1-99
PQITLWQRPLVTIKIGGQVKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVLIEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, I135T, S162C, F214L Q91K
>PA365| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVKLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVL

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006