<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PA342 PA342 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 31
2 AZT+DDC 35
3 3TC+D4T+IDV 56
4 3TC+D4T+EFV 83
5 DDI+IDV+RTV 17
6 DDI+LPV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, N37S, R41K, I64V, I93L  
>PA342| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMSLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I V35T, D123E, I142V, Q207A, V245Q W71R
>PA342| codons 1-246
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKRRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQL

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006