<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
FB109 FB109 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 13
2 3TC+AZT+SQV 83
3 3TC+D4T+IDV+RTV 9
4 3TC+D4T+IDV 122

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   L10V, K20R, E35D, M36I, R41K, R57K, D60E, Q61D, L89M  
>FB109| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYE
DILIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75I, F77L, T215A     T58S, R83K, K122E, I178L, T200A, Q207E, R211Q, E233A, V245Q K173P, D192G, K201Q
>FB109| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNSPV
FAIKKKDSTKWRKLIDLRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRPQNPDLVI
YQYMDDLYVGSGLEIGQHRAQIEELREHLLQWGFATPDKKHQKEPPFLWMGYALHPDKWT
VQPIQLPEKDSW

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006