<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
135 135PR Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 100
2 3TC+D4T+IDV 83
3 Unknown 48
4 3TC+AZT+IDV+RTV 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A Q58E L10V, K14R, I15V, E35D, M36I, R41K, R57K, Q61N, L63P, L89M  
>135PR| codons 1-99
PQITLWQRPVVTIRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKEYD
NIPIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006