<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
123 123PR Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+AZT+IDV 291

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, E35D, M36I, R41K, R57K, Q61N, L89M  
>123PR| codons 4-99
TLWQRPLVTIKVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIL
IEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006