<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
118 118PR Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 AZT+DDC+SQV 48
3 3TC+AZT+SQV 26
4 3TC+D4T+IDV 144
5 APV+DDI+EFV+RTV 43
6 APV+LPV+RTV 26
7 3TC+D4T+EFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54S, V82A L33F, Q58E L10I, I13V, I15V, G16E, K20R, E35D, M36I, N37D, Q61N, L63T, I85V, L89M  
>118PR| codons 1-99
PQITLWQRPIVTVKVEGQLREALLDTGADDTVFEDIDLPGRWKPKMIVGVGGFSKVREYD
NITIEICGHKAIGTVLVGPTPANIVGRNMLTQIGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006