<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
098 098PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, L210W, T215Y K219Q G190S   T39A, V60I, K122P, I135T, D177E, I178M, Q207H, R211K P97S, H198R
>098PR_RT| codons 1-225
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHSAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVSSDLEIGQRRTKIEELRHHLWKWGFYTPDQKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M   L10I, I15V, L19I, K20R, M36I, N37D, K45R, R57K, L63P, A71V, I85V, L89M, I93L  
>098PR_RT| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVLEEIDLPGRWKPRMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPTNIVGRNMMTQLGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006