<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
094 094PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 96
2 3TC+AZT+IDV+RTV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, M184V       D123E, S162C, K166R, R172K  
>094PR_RT| codons 1-194
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTRILEPFKKQNPDIVI
YQYVDDLYVGSDLE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M   L10V, I13V, K14R, I15V, K20T, N37E, I62V, L63P, I64V, T74S, V75I, I93L  
>094PR_RT| codons 1-99
PQITLWQRPVVTVRVGGQLTEALLDTGADDTVLEEMELPGRWKPKLIGGIGGFIKVRQYD
QVPVEICGHKAIGSILVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006