<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
091 091PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 52
2 3TC+AZT+IDV 131
3 Unknown 130

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17E, L63T, E65D  
>091PR_RT| codons 1-99
PQITLWQRPLVTIKIGEQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QITIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135T, D177E, T200A, R211K  
>091PR_RT| codons 1-225
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEP

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006