<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
044 044PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 22
2 AZT+DDI+SQV 43
3 3TC+AZT+IDV 43
4 D4T+DDI+RTV+SQV 43
5 DDI+RTV+SQV 48
6 AZT+DDI+EFV 31
7 DDI+IDV+RTV 22
8 D4T+DDI+LPV 70

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, F53L, G73S I3N, K14R, I15V, K20M, L63P, A71V, I72V, V77I, I85V, I93L  
>044PR_RT| codons 1-99
PQNTLWQRPFVTIRVGGQLMEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVVSTVLIGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R     E44D, V106I, V118I, K122E, I135T, S162C, T200A, E203D, H208Y, R211K, K223T  
>044PR_RT| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTPDRKHQTEPPFLWMGYE

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006