<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
017 017PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 122
2 3TC+D4T+IDV 31
3 3TC+AZT+NFV 87
4 3TC+AZT+EFV 30
5 D4T+EFV+IDV+RTV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, R57K, I62V, L63P, V82I  
>017PR_RT| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y   L100I, K103N   K22R, T139K, V179I, Q207A, H208Y, R211K  
>017PR_RT| codons 1-225
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRAYLLKWGFYTPDKKHQKEP

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006