<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
014 014PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 AZT+DDC 61
3 AZT+DDC+IDV 4
4 AZT+DDC+RTV 13
5 3TC+D4T+RTV 65
6 NFV 48
7 D4T+DDI+EFV+RTV+SQV 126

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, L33F, K43T, F53L L10I, I13V, K20R, E35D, M36I, N37E, L63P, A71V, I72T, I93L  
>014PR_RT| codons 1-99
PQITLWQRPIVTVKIGGQLREALIDTGADDTVFEDIELPGRWTPKMIGGIGGLVKVRQYD
QIPIEICGHKVTGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215F K219H L100I A98G V60I, V90I, K103E, K122E, I135T, S162Y, D177E, D192E, I202V  
>014PR_RT| codons 1-222
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEIQLGIPHPGGIKKEKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYMDDLYVGSELEIGQHRTKVEELRQHLLRWGFFTPDHKHQ

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006