<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
006 006PR_RT Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 39
2 3TC+AZT+SQV 205
3 3TC+D4T+EFV 126

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W   L100I, K103N A98G T39A, K122E, T200A  
>006PR_RT| codons 1-214
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2K, G17E, L19I, R57K, D60E, Q61E, L63P, A71T  
>006PR_RT| codons 2-99
KITLWQRPLVTIKIGEQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYEE
IPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006